PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00019.1.g00530.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 463aa    MW: 48199.6 Da    PI: 10.1482
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00019.1.g00530.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.41.6e-38170230262
                        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                   +e+ l+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGG+lrn+P+Ggg+r+nk+s+
  Zjn_sc00019.1.g00530.1.am.mk 170 PEQGLRCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGTLRNIPIGGGCRRNKRSR 230
                                   67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.8E-32172228IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-24174223IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.329174228IPR003851Zinc finger, Dof-type
PROSITE patternPS013610176212IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
LRRARPPSRA CGPSLHSLLA SPCSSGTLQP RAPSSPACSA PSSHPVPYSP LTQRGAVLLC  60
TLLNSGCWMR EAEAKATPAA LGGGGGTNDR GAETTGAVWA KRSRRGRIFY PRALIEQIRV  120
ASVLAICILG APAVYGAMTA VAAGDELLKG GTSGGGGTTT PRQQQPPPPP EQGLRCPRCD  180
SPNTKFCYYN NYSLSQPRHF CKTCRRYWTK GGTLRNIPIG GGCRRNKRSR STTSRVSLNL  240
RSVTVNASID QQQSSTRLGR FLGGGGAMVM SSPIGGVTSA DYQPGAAAGS MPPPRLNIPA  300
VGQYVPFVEW SSGPTAVDIT GGGGNSSAAA AMRSTIASFI ESQSFINQDL HWKLQQQRLS  360
TVSLAQPTSS AAGHTAPRRV GAGAFMQISA GAPVMGPMPT VTSWIMDSSC VFLSPPQPAN  420
TTSAVMATTT PNCNINSGLS NGDHATFNNS CDVGTIPTDD PIP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9475241e-67EU947524.1 Zea mays clone 346044 mRNA sequence.
GenBankKJ7269771e-67KJ726977.1 Zea mays clone pUT3678 C2C2-DOF transcription factor (DOF32) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982507.11e-68PREDICTED: dof zinc finger protein DOF5.7-like
TrEMBLK4ABQ41e-68K4ABQ4_SETIT; Uncharacterized protein
STRINGSi036311m4e-68(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.15e-30DOF zinc finger protein 1